PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 327aa    MW: 36517.8 Da    PI: 5.7922
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1696genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding66.26.1e-211663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+d+++ +G g+Wkt +++ g++R++k+c++rw +yl
      Gh_D08G1696 16 KGPWTPEEDEKLLDYINTHGHGNWKTLPKHAGLNRCGKSCRLRWANYL 63
                     79********************************************97 PP

2Myb_DNA-binding56.75.4e-1869113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+++eE+ l+v+++  lG++ W++Ia +++ gRt++++k++w+++
      Gh_D08G1696  69 RGRFSEEEERLIVNLHSTLGNK-WSKIATYLP-GRTDNEIKNFWNTH 113
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-26966IPR009057Homeodomain-like
PROSITE profilePS5129419.3031163IPR017930Myb domain
SuperFamilySSF466891.76E-3213110IPR009057Homeodomain-like
SMARTSM007178.6E-171565IPR001005SANT/Myb domain
PfamPF002491.4E-181663IPR001005SANT/Myb domain
CDDcd001673.22E-131863No hitNo description
PROSITE profilePS5129427.34564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2667118IPR009057Homeodomain-like
SMARTSM007177.7E-1768116IPR001005SANT/Myb domain
PfamPF002493.1E-1669113IPR001005SANT/Myb domain
CDDcd001671.61E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRSPCCSSD DANLKKGPWT PEEDEKLLDY INTHGHGNWK TLPKHAGLNR CGKSCRLRWA  60
NYLRPDIKRG RFSEEEERLI VNLHSTLGNK WSKIATYLPG RTDNEIKNFW NTHIRKKLLN  120
MGLDPNTHKP RTDLNHLLNL TQLICAAQLG SLVNPWESSA LKVQADAAQL LQNLIQTLNT  180
NQLSTITAGL MGSQKSYPYE GLINGTSSLY ADEPAPVPKK FHLMSQTSSD QHQGQGVIEN  240
SWASFEGYES SDISDFLISE LVPESPETAT TSMNQMGDDK TNTNHGSTVS PDSSIFQAWE  300
KLMDDETDNS FWKDILDLAS SPSSPIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31131184108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477974.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A0D2R0050.0A0A0D2R005_G
STRINGVIT_02s0012g01650.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.11e-83myb domain protein 39